egfr 210 dhivya

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
16551Domain completeStructure prediction dhivyaegfr 210 dhivya21021 Feb 202028 Aug 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210
   sequence: LMDEEDMDDVVDADEYLIPQQGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSSDPTGALTEDSIDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLNTVQPTCVNSTFDSPAHWAQKGSHQISLDNPDYQQDFFPKEAKPNGIFKGSTAENAEYLRVAPQSSEFIGA
 deepconcnf: ---HHHH------HH----------------------------------------------------EE------------------------------------------------------------------------------------------------------------------------HHHH--H--------------
    psipred: ------------HHHH-------------------------------------------------------------------------HHH-------------------------------------------HHHH------------------------------HHHH-------------------------------------
    spider3: -----------------------------------------------------------------------------------------HHH-------------------------------------------HHH----------------------------------H----------------------HH-------------
   disopred: -----------------------DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD--------------DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD----------------------DDDDDDDDDDDDDDDDDDDDD--------------DDDDDDDDDDDDD--------------DDDDDDD
      tmhmm: ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
16484110.00comparative modeling1-21021022 Feb 2020
-12n/aab initio1-210210-



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington