envelope

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
16610Domain completeStructure prediction mmaritanenvelope7521 Feb 202028 Aug 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
   sequence: MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV
   disopred: D--------------------------------------------------------------------------
      tmhmm: -----------TTTTTTTTTTTTTTTTTTTTTTT-----------------------------------------
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
-110.11comparative modeling1-7575-
16818120.69ab initio1-757526 Feb 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington