2P6J_2

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
182970CompleteStructure prediction zlz202201132P6J_25214 Jan 20221 Mar 2022
             1   .   10    .   20    .   30    .   40    .   50  
   sequence: MKQWSENVEEKLKEFVKRHQRITQEELHQYAQRLGLNEEAIRQFFEEFEQRK
    psipred: --HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHH--
    spider3: -------HHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHH---
 deepconcnf: --HHHHHHHHHHHHHHHHH----HHHHHHHHHH----HHHHHHHHHHHHH--
   disopred: DDDDDDDDDDD-------------------------------------DDDD
      tmhmm: ----------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
179094110.62ab initio1-525215 Jan 2022



Baker Lab | Rosetta@home | Contact | Terms of Service
©2022 University of Washington