2P5K_2

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
182971CompleteStructure prediction zlz202201132P5K_26414 Jan 20221 Mar 2022
             1   .   10    .   20    .   30    .   40    .   50    .   60    
   sequence: MNKGQRHIKIREIITSNEIETQDELVDMLKQDGYKVTQATVSRDIKELHLVKVPTNNGSYKYSL
 deepconcnf: --HHHHHHHHHHHHHH-----HHHHHHHHHH------HHHHHHHHHH---EEEE-----EEEE-
    psipred: --HHHHHHHHHHHHH------HHHHHHHHHH----EEEHHHHHHHHHH--EEEE-----EEEE-
    spider3: --HHHHHHHHHHHHHH-----HHHHHHHHHH----EEHHHHHHHHHH---EEEE-----EEE--
   disopred: DDDD------------------------------------------------------D-----
      tmhmm: ----------------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
179095110.90ab initio1-646415 Jan 2022



Baker Lab | Rosetta@home | Contact | Terms of Service
©2022 University of Washington