2P81_2

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
182972CompleteStructure prediction zlz202201132P81_24414 Jan 20221 Mar 2022
             1   .   10    .   20    .   30    .   40    
   sequence: AKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKIKKS
    psipred: ---HHHH-----HHHHHHHHHH----HHHHHHHHHHHHHHH---
    spider3: HHHHHHH-----HHHHHHHHHH----HHHHHHHHHHHHHHHH--
 deepconcnf: -HHHH-------HHHHHHHHHHH---HHHHHHHHHHHHHH----
   disopred: -----------------------------------------DDD
      tmhmm: --------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
179096110.66ab initio1-444415 Jan 2022



Baker Lab | Rosetta@home | Contact | Terms of Service
©2022 University of Washington