kmt2c 4391-4431

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
182998Domain parse completeDomain predictionAsube-zhkmt2c 4391-44314115 Jan 20221 Mar 2022
             1   .   10    .   20    .   30    .   40 
   sequence: DCRKCCFCHEEGDGLTDGPARLLNLDLDLWVHLNCALWSTE
   disopred: -----------------------------------------
      tmhmm: -----------------------------------------
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
-110.77comparative modeling1-4141-



Baker Lab | Rosetta@home | Contact | Terms of Service
©2022 University of Washington