kmt2c4902 MUT 43

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
183002CompleteStructure predictionAsube-zhkmt2c4902 MUT 434115 Jan 20221 Mar 2022
             1   .   10    .   20    .   30    .   40 
   sequence: DCRKCCFCHEEGDGLTDGPARLLNLDLDLWVHLNCVLWSTE
    psipred: ---EEE--------------EEEE----EEEEEEEEEE---
    spider3: --------------------EEEE-----EEEEEEEEE---
 deepconcnf: --------------------EEEE------EEEEEEEE---
   disopred: -----------------------------------------
      tmhmm: -----------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
179175110.77comparative modeling1-414115 Jan 2022



Baker Lab | Rosetta@home | Contact | Terms of Service
©2022 University of Washington