kmt2c4902 MUT ROSE

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
183005CompleteStructure prediction Asube-zhkmt2c4902 MUT ROSE4115 Jan 20221 Mar 2022
             1   .   10    .   20    .   30    .   40 
   sequence: DCRKCCFCHEEGDGLTDGPARLLNLDLDLWVHLNCVLWSTE
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
179025110.80RoseTTAFold1-414115 Jan 2022



Baker Lab | Rosetta@home | Contact | Terms of Service
©2022 University of Washington