nsp1

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
22664Domain completeStructure predictionMariiaKlimovansp118023 Apr 202010 Aug 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180
   sequence: MESLVLGVNEKTHVQLSLPVLQVRDVLVRGFGDSVEEALSEAREHLKNGTCGLVELEKGVLPQLEQPYVFIKRSDALSTNHGHKVVELVAEMDGIQYGRSGITLGVLVPHVGETPIAYRNVLLRKNGNKGAGGHSYGIDLKSYDLGDELGTDPIEDYEQNWNTKHGSGALRELTRELNGG
   disopred: DDDDDDDD-D------------------------------------------------------------------------------------------------------------------------------------------------------------------------DD
      tmhmm: ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Predicted Domains

Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
22449110.83comparative modeling1-14114126 Apr 2020
-210.39comparative modeling136-18045-



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington