2020-04-25_00000038_1_11

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
22830CompleteStructure predictioncameo2020-04-25_00000038_1_1114525 Apr 2020-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
   sequence: GSMDQPAGLQVDYVFRGVEHAVRVMVSGQVLELEVEDRMTADQWRGEFDAGFIEDLTHKTGNFKQFNIFCHMLESALTQSSESVTLDLLTYTDLESLRNRKMGGRPGSLAPRSAQLNSKRYLILIYSVEFDRIHYPLPLPYQGKP
    psipred: --------EEEEEEE----EEEEEEE---EEEEEEEE---HHHHEEE--HHHHHHHHHH------HHHHHHHHHHHHH----EEEEEE--HHHHHHHHH--------------------EEEEEEEEE---EEE-----------
    spider3: --------EEEEEEE--EEEEEEEEEE--EEEEEEEE------EEEEE-HHHHHHHHHHH-----HHHHHHHHHHHHH-----EEEEEE-HHHHHHHHHH-------------HHH---EEEEEEEE------------------
 deepconcnf: -------EEEEEEEE--EEEEEEEEEE--EEEEEEEE----HHHE----HHHHHHHHHHH-----HHHHHHHHHHHHH----EEEEEEE-HHHHHHHHHHH------------------EEEEEEEE----EEEE----------
   disopred: DDDDDDDDDDD-----------------------------------------------------------------------------------DDDDDDDDDDDDDDDDDDDDDDDDDDD---------------------DDD
      tmhmm: -------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
22253110.50comparative modeling1-14514525 Apr 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington