CAQDDT

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
26726CompleteStructure prediction Michael111111CAQDDT55523 May 202026 Jun 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .
   sequence: DEDAMCCWALSEWAEAWSNHYYTDIWHMNKCKWRYRVERHARWSLCEGLAGKWPVELCGQFTNSHQRFFRKVMIIVKRKCWLNVHTHREMSYWVEQTVHGELGCDCYCDGCCCWLNPIHIPDDLDHRELQQGKLHELYGFSPMIDPQNEQACTYVELMEKGDQACCESKQSAQVRWKWVSYMFVMPFVSVKMYVCARFNLVDPQSMCNKTEHQWYILNCWHFILTIWHQMREWWHAYAGRVDRSWGKADEATMSNTSMVLNDAESVIGVYVMWTFPEYGRRRGPSAYFSHYKFRENYNKDNSAHWFTNKSFLAQIEMGHCQNPQPNDWWCWPLEIHHVVRPSCLHNFMLEPYPQMLPKYEQVKAEHKKVSTEVRGGKWFFGWRGLSFPVHFADSYWWIFKYCMGVEQNCYKTWWFPYQPPHPTMWPVSGFCPVATGHYWQSRQCVNWLTTRNSCPIVQKKLQGAMKMGWQEENTECNHGCSIGIICLWGAVYHSYHDQGTDFPQAFNEAWKQVFKAIISGANESGVQWHVTRMRVWRWWWRFQGMAPIACAQDDT
    psipred: ----HHHHHHHHHHHHHH---HHHHHH-----EEEEHHHHHHHHHHH-------HHHHHHH--HHHHHHHHEEEEEEEEEEEEE---HHHHHHHHHHH-------EE---EEEE-----------HHHHH---HHHHH-------------HHHHHHHHH--HHHH------EEEEEEEEEEEEE---EEEEEEEEEE----HHHHH-----EEEEHHHHHHHHHHHHHHHHHHHHHH-----------HHH----EEEE--HHHHEEEEEEEE-HHH-------HHHHHHHHHHH--------EE--HHHHHHHHH----------EEEE-EEEEEE--HHHHHHH-----HHH--HHHHHHHHH-EEEEEE---EEEEE------EEE----HHHHHHHHHHHHH--EEEEE------------------------HHHHHHHHHHH-----HHHHHHHHHHHHH--------------EEEEEEHHHHHHHHH------HHHHHHHHHHHHHHHH--------EEEEEEHHHHHHHHHH-------------
    spider3: -HHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHEEHHHEEEE----------EEE--------EEEEEEEEEEEEEEEEE-EE---EEEEEEEEEE----------------------------HHHHHHHHHHH---------------EEEEEE--------------HEEEEEEEEEEEEEEEEEEEEEEEEE---------------EEEE-EEEEEEEHHHHHHHHHHHH--------------------EE------EEEEEEEEE-------------EEEEEE-----------EE---EEEEEEEE-------------E-EEEEEEE---------------------EEE--------EE---EEEE--------EEEE-HHHHEEHH----------------------------E-------EEE----E-EEE-------EEEEE----E--------------EEEEEEEE--EEE---------HHHHHHHHHHHHHHHHH-------EEEEEEEEEEEEEEEE-------------
 deepconcnf: ----HHHHHHHHHHHHHH--------------EEEEE-----EEEH-----------------HHHHHHHHHHHHHHHHHH----------EEEEE---------EEE--EEEEEEEEE------HHHHH--HHHHH----------------HHHHHHH--HHHH------EEEEEEEEEE------EEEEEEEEEE--------------HHHHHHHHHHHHHHHHHHHHHHHHH----------------------------EEEEEEEEE----------------------------------HHHHHHHHH----------------HHHH------HHHH-----------HHHHHHH--EEEEEEE--EEEEEE-------E---HHHHHHHHHH--------------------------------------HHHHHHHH-----HHHHHHHHHHHH--------------HHHHHHHHHHHHHHH------HHHHHHHHHHHHHHHHHHHHHH----EEEEHHHHHHHHHHH-------E-----
   disopred: DD----------------------------------------------------------------------------------------------------------------------------------------------------------------DDDDDDDDD--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DDDDDDDDDDDDD---------------------------------------------------------------------------------------------DD------------------------------------------------------------------------------------DDDD
      tmhmm: ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
26272110.01comparative modeling1-55555525 May 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington