AVP1061

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
26741CompleteStructure prediction vinitaAVP10613523 May 202025 Jun 2020
             1   .   10    .   20    .   30    .
   sequence: MSTNPKPQRKTKRNTNRRPQDVKFPGGGQIVGGVY
    psipred: ----------------------------EEEEEE-
    spider3: -----------------------------------
 deepconcnf: ----------------------------EEEEEE-
   disopred: DDDDDDDDDDDDDDDDDDDDD--------------
      tmhmm: -----------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
26296110.97comparative modeling1-353525 May 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington