AVP1109

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
26747CompleteStructure prediction vinitaAVP11093023 May 202025 Jun 2020
             1   .   10    .   20    .   30
   sequence: YLRGVNRSLHGIWPGKICKGVPTHLATDVE
    psipred: --------HH---HHHHH------------
    spider3: ------------------------------
 deepconcnf: ------------------------------
   disopred: DDDDD-----------------D-DDDDDD
      tmhmm: ------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
26320110.33comparative modeling1-303025 May 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington