HLA-DRB1-07:01

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
31136CompleteStructure prediction KhanshahxebHLA-DRB1-07:018930 Jun 20201 Aug 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .    
   sequence: RFLWQGKYKCHFFNGTERVQFLERLFYNQEEFVRFDSDVGEYRAVTELGRPVAESWNSQKDILEDRRGQVDTVCRHNYGVGESFTVQRR
   disopred: ----------------------------------------------------------------------------------------D
      tmhmm: -----------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
30596111.00comparative modeling1-89892 Jul 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington