Q65990

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
31140CompleteStructure prediction itoniQ6599035130 Jun 20201 Aug 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350 
   sequence: MAIKEDPRLVKMASLGVPWAVKVTTKGWGSLTTKQKIAARAALQIPMRVTKQPTPKVVRVSAPAAVSYREVTGAPRVTTAGKVLTHTASELITTLKKNTSLEPKYVEAIVNPSRVGTFNQLPDIAASYEKYKFTSLRFRYSSTCPTSTGGKVALAFERDAANPLPDNLTAFYNLEGNTSSNPRDSFVLTVPCDNVARFVADGGSDPKLVDFGKLLAASYGQGEGDANGLGEIHIEYTVQLYNRLGSAQRSQIGSLDGKFLGPRLVEVTSGKSDKGTKFTFSFHGCGLIPILWLAKPRWPLTAGSAVACEVLGQSGDDSVQWAGIRISEREQTVEFEHTETTPEAKWSVSRL
 deepconcnf: ------HHHHHHHH--HHHHHHHHH-------HHHHHHHHH-----------------E------------------------EEEE--EEEEEE--------EEEEEEE----------HHHHHH----EEEEEEEEEEEE--------EEEEEEE----------HHHH--------------EEEEE----HHHHH-------EEEE---EEEEEE---------EEEEEEEEEEEEEE--------EEEE--------EEEEEEE-------EEEEEEEE--EEEEEEEEE----------EEEEEEE------EEEEEEEEEE---EEEEEE-----EEEEEEEE-
    psipred: ------HHHHHHHH---HHHHHHHH-------HHHHHHHHH--------EEEEEEEEEEE----------------------EEEEEEEEEEEEE-------EEEEEEEE--------HHHHHHHH----EEEEEEEEEE----------EEEEEE-----------HHHHH--------------EEEE-----------------EEE--EEEEEEE----------EEEEEEEEEEE---------EEEEE---------EEEEE--------EEEEEEE--EEEEEEEEE------EE--EEEEEEEEE----EEEEEEEEEE----EEEEEE-----EEEEEEEE-
    spider3: ------HHHHHHHHH-HHHHHHHHH--HH---HHHHHHHHHH-------------EEEEEE---------------------EEEEEEEEEEEEEE-------EEEEEEE----HHH---HHHHHH----EEEEEEEEEEE--------EEEEEEE-----------HHHHHH---EEE------EEEEEE----EEEE------HHHHH--EEEEEEE-----------EEEEEEEEEEE-------EEEEEEE--------EEEEEE-------EEEEEEE---EEEEEEEEE-----E----EEEEEEEE-----EEEEEEEE-----EEEEEE-----EEEEEEEE-
   disopred: DDDDDD-DDDD--------------DDDDDDDDDDDDDDDDDDDDDD---------DDDDDDDDDDDDDDDDDDDDDDDDDD-----------------------------------------------------------------------------------------------------------------------------------------------------------------------D--DDDDD----------------------------------------------------------------------------------------------
      tmhmm: ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
30471110.68comparative modeling1-35135130 Jun 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington