sll0944

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
31141CompleteStructure prediction Juliasll094416430 Jun 20201 Aug 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    
   sequence: MQCLGKIFLSPGTKPESKNLIVIIFTADRDQRVLALSRIVKRPFFNKNPMPAMSQILDPIPNNQPSALFCCYVNATNQIQVARITNVPNWYFERVVFPGQRLVFEAVPSAQLEIHTGMMASSIISDTIPCEQLSIDPDGLAAGGFISPEKEHESEDMTSQSLVA
 deepconcnf: --EEEEEE----------EEEEEEEEE-----EEEE-----------------HHH-----------EEEEEEE----EEEEEE-----EEEEEEEE---EEEEEE----EEEEE------EEE--------EEE-----EE-EE-------------------
    psipred: -----EEEE----------EEEEEEEE----EEEEE--EE------------HHHH----------EEEEEEE----EEEEEEE------EEEEEEE---EEEEE---HHHHHHHHHHHHHHHH-------EEEE-----------------------------
    spider3: -------------------EEEEEEE----HEEEEEEEE---------------EEE----------EEEEEE----EEEEEEEE------EEEEE----EEEEE--HHHHHHHHHHHHHHHHHH------EEEE-----------------------------
   disopred: DDD---------------------------------------------------------------------------------------------------------------------------------------------DDDDDDDDDDDDDDDDDDDD
      tmhmm: --------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
30469110.20ab initio1-16416430 Jun 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington