P0DTD3.1_prediction

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
31148Domain completeStructure prediction emiliomastrianiP0DTD3.1_prediction7330 Jun 202010 Aug 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70   
   sequence: MLQSCYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAMAVMLLLLCCCLTD
   disopred: DD--------DDDDDDDDDDDDDDDDD----------------------------------------------
      tmhmm: -------------------------------------------------------------------------
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
-110.12comparative modeling1-7373-
30506120.71ab initio1-73731 Jul 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington