CrtY_HALSA

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
31153CompleteStructure prediction RosarioValentiCrtY_HALSA23730 Jun 20205 Aug 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  
   sequence: MTTSYLTFLAVAVGPPLVALGVVRAARWDGDRARAAGVGILLALALSYTTPWDNYLIATGVWWYGEGTVVGRLWQMPIEEYLFVITQTLLTGLWVQALPLRPTAGFSPTRRDAVLGALAGVLVGCGGAVLLTVDATFYIGAIIAWAAPVLALQWAVGWRYLWRRRRVFAAAVLVPTLFLSAADRYAIADGIWILAGQYTTGITVLGLPIEEGAFFFVTNVFVSQGLILYAWVLARWR
 deepconcnf: ---HHHHHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHHHHHHH--------EEEEEE----HHHHHHHHHHHHHHHHHHHH------------HHHHHHHHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHH----EEEEE---EEEEEE----HHHHHHHHHHHHHHHHHHHHHHHHHH---
    psipred: ---HHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----EEE----HHHHEE---HHHHHHHHHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----EEEE----EE--EE----HHHHHHHHHHHHHHHHHHHHHHHHHHHH-
    spider3: --HHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHH---------HHHHHH----HHHHHHHHHHHHHHHHHHHHHH--------HHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----EEE--------E---HHHHHHHHHHHHHHHHHHHHHHHHHHHHH--
   disopred: ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
      tmhmm: ---TTTTTTTTTTTTTTTTTTTT------------TTTTTTTTTTTTTTTTTTTTTTT-------------------TTTTTTTTTTTTTTTTTTTTTTT------------TTTTTTTTTTTTTTTTTTTT---TTTTTTTTTTTTTTTTTTTTTTT-----------TTTTTTTTTTTTTTTTTTTTTTT-------------------TTTTTTTTTTTTTTTTTTTTTTT---
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
30542110.08comparative modeling1-2372371 Jul 2020
30846120.59ab initio1-2372375 Jul 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington