2020-08-01_00000122_1_11

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
33884CompleteStructure predictioncameo2020-08-01_00000122_1_11561 Aug 2020-
             1   .   10    .   20    .   30    .   40    .   50    . 
   sequence: ARTKQTIHPGVTCDGCQMFPINGSRFKCRNCDDFDFCETCFKTKKHNTRHTFGRIN
    psipred: ----------EE--------EEE--EE---------HHHHH---------EEEEE-
    spider3: -----------E---------EEEE----------HHHHHHH---------EEE--
 deepconcnf: -----------------------EEEE--------HHHHHH----------EEE--
   disopred: DD------------------------------------------------------
      tmhmm: --------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
33077110.82comparative modeling1-56561 Aug 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington