2020-08-01_00000176_1_11

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
33896CompleteStructure predictioncameo2020-08-01_00000176_1_112581 Aug 2020-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .   
   sequence: GGGTMQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPAGILARQPLSLFGPPGTVLLGLFCVHYFHRTFVYSLLNRGRPYPAILILRGTAFCTGNGVLQGYYLIYCAEYPDGWYTDIRFSLGVFLFILGMGINIHSDYILRQLRKPGEISYRIPQGGLFTYVSGANFLGEIIEWIGYALATWSLPALAFAFFSLCFLGLRAFHHHRFYLKMFEDYPKSRKALIPFIF
 deepconcnf: ----------HHHHHHHHHHHHHHHHHHHHHH--------------------HHHHHHH------HHHHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHHH------HHHHHHHHHHHHHHHHHHHHHHHHH----------HHHHHHHHHHHHHHHHHHHHHHHHHHH----------------------HHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHH----------E-----
    psipred: ----------HHHHHHHHHHHHHHHHHHHHHH---------------------HHHHHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHHHH------HHHHHHHHHHHHHHHHHHHHHHH------------HHHHHHHHHHHHHHHHHHHHHHHHHHH-------EE--------EE----HHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------EEE--EE-
    spider3: ----------HHHHHHHHHHHHHHHHHHHHHHH--HHHH-------------HHHHHHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHHHH---------HHHHHHHHHHHHHHHHHHHHHHHHHHH--------------HHHHHH--HHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHH----------------
   disopred: DDDDDD------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
      tmhmm: ------------TTTTTTTTTTTTTTTTTTTT--------------------------------------TTTTTTTTTTTTTTTTTTTTTTT--------------------TTTTTTTTTTTTTTTTTTTTTTT------------TTTTTTTTTTTTTTTTTTTTTTT------------TTTTTTTTTTTTTTTTTTTTTTT----TTTTTTTTTTTTTTTTTTTTTTT-------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
33091110.51comparative modeling1-2582581 Aug 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington