RpnC-S 8 repeats

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
37939CompleteStructure prediction kklierRpnC-S 8 repeats7316 Sep 202017 Oct 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70   
   sequence: MTLAQWFEEKGRQEERQEVRQEVRQEVRQEVIQEVRQEVRQEYALRFLSKGMSREDVAEMANLPLAEVDKLIN
    psipred: --HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHH---HHHHHHH--
    spider3: --HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHH---HHHHHHH--
 deepconcnf: --HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHH---HHHHHHH--
   disopred: ----------------DDDDDDDDDDDDDDDDDDDDDD---------------------------------DD
      tmhmm: -------------------------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
37097110.50comparative modeling1-737316 Sep 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington