O39433

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
37944Domain completeStructure prediction PanyawarinO394337116 Sep 202025 Oct 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70 
   sequence: MLSLVSPLLKKSIVIQLFSITVYKFKAKFWYKLPFETRLCIIKHTRPKALSVTKQVKRDYRKIAILNSMRK
 deepconcnf: ----HHHHHHHHHHHHHH-HEEHH----------HHHHHHHHHH-------HHHHHHHHHHHHHHHHHHH-
    spider3: ------HHHHHHHHHHHHHHHHH-----------HHEEEEEE--------EEEE-----HHHHHHHHH---
    psipred: ----HHHHHHHHHHHEEEEEEEEEEHH--HH---HHEEEEEE------HHHHHHH----HHHHHHHHHH--
   disopred: DD---------------------------------------------DDDDDDDDDD-----------DDD
      tmhmm: -----------------------------------------------------------------------
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
37578110.07comparative modeling1-717121 Sep 2020
-12n/aab initio1-7171-



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington