1A_extendedbased on 4A_07072020.pdb

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
37970CompleteStructure prediction Dhirendra1A_extendedbased on 4A_07...14916 Sep 202016 Oct 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .    
   sequence: MKHHHHHHPMSDYDIPTTENLYFEGAMAQFRGEFTPKTQLTMLSARAGLVMDPGSKVTYNGVEIGRVDTISEVTRDGESAAKFILDVDPRYIHLIPANVNADIKATTVFGGKYVSLTTPKNPTKRRITPKDVIDVRSVTTELEHHHHHH
   disopred: DDDDDDDDDD---------------------------------------------------------------DDDD------------------------------------------DDDDDDDDDDDD----------------DD
      tmhmm: -----------------------------------------------------------------------------------------------------------------------------------------------------
| Download | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
3711911n/acomparative modeling1-14914916 Sep 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington