rtymnbvhg

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
388770CompleteStructure prediction ASDFG81rtymnbvhg446 Aug 202220 Sep 2022
             1   .   10    .   20    .   30    .   40    
   sequence: MKQSQFFKKMIPIHGLTTFIAIIGLFLLWPIDSAEAVLKKGAIA
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
383892110.85RoseTTAFold1-44446 Aug 2022



Baker Lab | Rosetta@home | Contact | Terms of Service
©2022 University of Washington