sti-dtnv-ctk

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
41324CompleteStructure prediction rugsti-dtnv-ctk8717 Oct 202016 Nov 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .  
   sequence: STIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNDTNVDTNVDTNVTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILMCTK
   disopred: DDDDDD---------------------------------------------------------------------------------
      tmhmm: ---------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
40328110.53TrRosetta1-878717 Oct 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington