abiK-middleHelical

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
41328CompleteStructure prediction ksteczkabiK-middleHelical13117 Oct 202017 Nov 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130 
   sequence: SNDKWIKEISNFIDYCVNEEHLGNKGAIKCIFPVITNTLKQKKVDTKNIDNIFSKRNMVTNFNVFEKILDLSLKDSRLTNKFLTFFENINEFGFSSLSASNIVKKYFSNNSKGLKEKIDHYRKNNFNQELY
    psipred: -HHHHHHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHHHHHHHHHHH--------HHHHHHHHHH---HHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHH--------
    spider3: -HHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHH----HHHHHHHH----------HHHHHHHHHH--HHHHHHHHHHHHHHHH----HHHHHHHHHHHHHH-HHHHHHHHHHHHH----HHHH
 deepconcnf: -HHHHHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHH-----HHHHHHHH--------HHHHHHHHHHH---HHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHHHHHHHHHHH--------
   disopred: DDDD---D----------------------------------------------------------------------------------------------------------------------DDDDD
      tmhmm: -----------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
40333110.36ab initio1-13113117 Oct 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington