R9HM001M1

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
41350CompleteStructure prediction tgdz49R9HM001M126218 Oct 202017 Nov 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260  
   sequence: CLTAPPKQAAKPTLMPRAQSYKDLTHLPAPTGKIFVSVYNIQDETGQFKPYPASNQSTAVPQSATAMLVTALKDSRWFIPLERQGLQNLLNERKIIRAAQENGTVAMNNRIPLQSLTAANIMVEGSIIGYESNVKSGGVGARYFGIGADTQYQLDQIAVNLRVVNVSTGEILSSVNTSKTILSYEVQAGVFRFIDYQRLLEGEIGYTSNEPVMLCLMSAIETGVIFLINDGIDRGLWDLQNKAERQNDILVKYRELSVPPES
 deepconcnf: -------------------HHHHHH--------EEEEEEEEE------E------------HHHHHHHHHHHHH---EEEEE---HHHHHHHHHHHHHHHH-------------------EEEEEEEEEE---------EEEEEEEEEEEEEEEEEEEEEEEEEE----EEEEEEEE--EEEEEEEEEEEEEEEE--EEEEEEEEE---HHHHHHHHHHHHHHHHHHHH-------EEEEE------HHHHHHHHH------
    psipred: -------------------HHHHHHH-------EEEEEEEEE-------------------HHHHHHHHHHHHH---EEEEE---HHHHHHHHHHHHHHHHH------------------EEEEEEEEEE----------EEE--EE----EEEEEEEEEEEEEE----EEEEEEEEEEEEEEEEE--EEEEEE----EEEEE-------HHHHHHHHHHHHHHHHHHHHHH--------------HHHHHHHHHHHHHHH-
    spider3: ---------------------HHHH--------EEEEEEEEE-----E-------------HHHHHHHHHHHHH----EEEE---HHHHHHHHHHHHHHH--------------------EEEEEEEEEEE--------------------EEEEEEEEEEEEEE-----EEEEEEEEEEEEEEEEE--EEEEE---EEEEE--------HHHHHHHHHHHHHHHHHHHHHH---------HHHH-HHHHHHHHHHH-----
   disopred: DDDDDDDDDDDDDDDDDDDD------------------------------------------------------------------------------DDDDDDDDDDDDDDDD---------------------------------------------------------------DDDDDDD------------------------------------------------------------------------D-DDDD
      tmhmm: ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
40361110.88comparative modeling1-26226218 Oct 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington