fcw25

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
435598ExpiredStructure prediction Xuyang Wangfcw254024 Oct 20228 Dec 2022
             1   .   10    .   20    .   30    .   40
   sequence: MFESLIPRGTMGRFEARKIVTIDSGFPVHGIEVRDLNLMS
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
431008110.76RoseTTAFold1-404024 Oct 2022



Baker Lab | Rosetta@home | Contact | Terms of Service
©2023 University of Washington