fcw25
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 435598 | Expired | Structure prediction | Xuyang Wang | fcw25 | 40 | 24 Oct 2022 | 8 Dec 2022 |
1 . 10 . 20 . 30 . 40
sequence: MFESLIPRGTMGRFEARKIVTIDSGFPVHGIEVRDLNLMS
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 431008 | 1 | 1 | 0.76 | RoseTTAFold | 1-40 | 40 | 24 Oct 2022 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2023 University of Washington