2020-11-22_00000135_1_11

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
45736CompleteStructure predictioncameo2020-11-22_00000135_1_1110522 Nov 2020-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
   sequence: GPQRNGRAPEGKMDLIIMRGDKGFGFRLSGATHSAAEQTAQGQWVRNVDPDGQAARAGLQAGDRLLELNGVDVSFWSHRKVVDEIKRSGDVVAFRIARRLSPGPD
   disopred: DDDDDDDDDDDDDD--------------------------------------------------------------------------------DDDD-DDDDDD
      tmhmm: ---------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
44668110.80TrRefineRosetta1-10510522 Nov 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington