BRD4-L 720-820

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
45752CompleteStructure prediction Sun RongBRD4-L 720-82010022 Nov 202022 Dec 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
   sequence: MAPKSKKKGHPGREQKKHHHHHHQQMQQAPAPVPQQPPPPPQQPPPPPPPQQQQQPPPPPPPPSMPQQAAPAMKSSPPPFIATQVPVLEPQLPGSVFDPI
 deepconcnf: ----------------------------------------------------------------------------------------------------
    psipred: --------------------HHHHHHH----------------------HHHH-----------HHHHHHHHHH--------EE----------------
    spider3: ----------------------------------------------------------------------------------------------------
   disopred: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD-------------------DD-DDD
      tmhmm: ----------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
44702110.31comparative modeling1-10010022 Nov 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington