921-1020

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
45754Domain parse completeStructure prediction Sun Rong921-102010022 Nov 202022 Dec 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
   sequence: PPLTSMQMQLYLQQLQKVQPPTPLLPSVKVQSQPPPPLPPPPHPSVQQQLQQQPPPPPPPQPQPPPQQQHQPPPRPVHLQPMQFSTHIQQPPPPQGQQPP
   disopred: DDDD-DD-------------------DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD------DDDDDDDDDDDDDDDD
      tmhmm: ----------------------------------------------------------------------------------------------------
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
-110.06comparative modeling1-100100-
-12n/aab initio1-100100-



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington