1021-1120

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
45755CompleteStructure prediction Sun Rong1021-112010022 Nov 202023 Dec 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
   sequence: HPPPGQQPPPPQPAKPQQVIQHHHSPRHHKSDPYSTGHLREAPSPLMIHSPQMSQFQSLTHQSPPQQNVQPKKQELRAASVVQPQPLVVVKEEKIHSPII
 deepconcnf: --------------HHHHHHHH--------------------------------------------------HHHH-----------EEE----------
    psipred: --------------HHHHHHH-------------------------------------------------------------------EE----------
    spider3: -------------------------------------------------------------------------HHH------------EEEEE-------
   disopred: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD-DDDDD
      tmhmm: ----------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
44706110.29comparative modeling1-10010022 Nov 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington