1121-1220

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
45756CompleteStructure prediction Sun Rong1121-122010022 Nov 202023 Dec 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
   sequence: RSEPFSPSLRPEPPKHPESIKAPVHLPQRPEMKPVDVGRPVIRPPEQNAPPPGAPDKDKQKQEPKTPVAPKKDLKIKNMGSWASLVQKHPTTPSSTAKSS
 deepconcnf: ----------------------------------------EE---------------------------------------HHHHH--------------
    psipred: --------------------------------------------------------HHHHH--------------------HHHHH--------------
    spider3: ---------------------------------------------------------------------------------HHHH---------------
   disopred: DDDDDD-DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD-------DDDDDDDDDDDDDDDDDD
      tmhmm: ----------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
44707110.30comparative modeling1-10010022 Nov 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington