6mk5.pdb

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
45759CompleteStructure prediction jarizala6mk5.pdb3422 Nov 202022 Dec 2020
             1   .   10    .   20    .   30    
   sequence: ACLGQWDSCDPKASKCCPNYACEWKYPWCRYKLF
   disopred: D----D----------------------------
      tmhmm: ----------------------------------
| Download | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
4470311n/acomparative modeling1-343422 Nov 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington