mCG1050357

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
483357ErrorStructure prediction MVOGmCG105035717124 Jan 202315 Mar 2023
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170 
   sequence: MCSNVCVCVCVCVCVCVCVCVCVCLCVSVSGMSDMYACVYVYVCMYVCMYVHMYVCMYVCMYVYVCVCLCVCVFVCVCVVSVVCVYAFVYMCICVSMCFCQWNEWHVCMCMYVDMCVVFMCLCIRGKCGVCACVSVCVCLCTSLYKYLCLYVGICILRHCCVSMFIEKKTV
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
47857011n/aRoseTTAFold1-17117128 Jan 2023



Baker Lab | Rosetta@home | Contact | Terms of Service
©2023 University of Washington