PH

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
483360CompleteStructure prediction amarantoPH6424 Jan 202314 Mar 2023
             1   .   10    .   20    .   30    .   40    .   50    .   60    
   sequence: TLGLVVLGVAYAQLAILLVSSCVDSLWSVAQALLVLCPGTGLSTLCPAESWHLSPLLCVGLWAL
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
478572110.68RoseTTAFold1-646428 Jan 2023



Baker Lab | Rosetta@home | Contact | Terms of Service
©2023 University of Washington