PRNP N-terminus
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
498754 | Complete | Structure prediction | Z_Robinson | PRNP N-terminus | 72 | 18 Mar 2023 | 7 May 2023 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70
sequence: KKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGTWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGG
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
493685 | 1 | 1 | 0.64 | RoseTTAFold | 1-72 | 72 | 19 Mar 2023 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2023 University of Washington