thymine kinase
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 498756 | Complete | Structure prediction | madiwal_2022 | thymine kinase | 191 | 18 Mar 2023 | 7 May 2023 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190
sequence: MSSLSFTFGVVMSGKTKQFIQTVKNEKKSVLVMKPDTDFKFKENRIESRNGTFVNADVIISPNMDLYNDICYNNFDKIYIDESQFLTEKHVDQLRRVASDKDKDICCYGIRTDFRNNLFEGSKRLFEVCDSIYEIIVKCNYCENKASHNLKVINGESTSEGEKINSQFLTCEIFFPTCYGCYSRILKEKRL
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 493687 | 1 | 1 | 0.82 | RoseTTAFold | 1-191 | 191 | 19 Mar 2023 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2023 University of Washington