randm_BCA_38_92_0105_AI

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
52121CompleteStructure prediction riccardo.nifosirandm_BCA_38_92_0105_AI5813 Jan 202113 Feb 2021
             1   .   10    .   20    .   30    .   40    .   50    .   
   sequence: SLTEKVEKRGKWREYLLRYTDSMEEELKKAEEEWKQFGGGDEEKKKDGKRRKEEFLKK
    psipred: -HHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHH--
    spider3: -----------HHHHHHHH---HHHHHHHHHHHHHHH---------------------
 deepconcnf: -HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHH--
   disopred: DDDDDDDDD------------DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
      tmhmm: ----------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
50860110.39ab initio1-585813 Jan 2021



Baker Lab | Rosetta@home | Contact | Terms of Service
©2021 University of Washington