Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
---|---|---|---|---|---|---|---|
52132 | Complete | Structure prediction | nmlewis | RPA4631_Fer1 | 64 | 13 Jan 2021 | 13 Feb 2021 |
1 . 10 . 20 . 30 . 40 . 50 . 60 sequence: MAYKIVTSQCTVCGACEFECPNAAISMKRGTYVIDATKCTECEGQFDKPQCVSVCPVDNTCVPA disopred: ---------------------------------------------------------------- tmhmm: ----------------------------------------------------------------
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
---|---|---|---|---|---|---|---|
50883 | 1 | 1 | 0.79 | TrRefineRosetta | 1-64 | 64 | 13 Jan 2021 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2021 University of Washington