RPA4631_Fer1

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
52132CompleteStructure prediction nmlewisRPA4631_Fer16413 Jan 202113 Feb 2021
             1   .   10    .   20    .   30    .   40    .   50    .   60    
   sequence: MAYKIVTSQCTVCGACEFECPNAAISMKRGTYVIDATKCTECEGQFDKPQCVSVCPVDNTCVPA
   disopred: ----------------------------------------------------------------
      tmhmm: ----------------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
50883110.79TrRefineRosetta1-646413 Jan 2021



Baker Lab | Rosetta@home | Contact | Terms of Service
©2021 University of Washington