SHY
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
521945 | Complete | Structure prediction | Rabbit | SHY | 111 | 26 May 2023 | 10 Jul 2023 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110
sequence: MDSHYSHYSHYSHYSHYSHYPSSSGSHTSHYSHYSHYSHYSHYGGIEKKIEAHEKKHEAIEKKIEAPGGGGGSIEKKIEAHEKKHEAIEKKIEAGTPVPSTPPTPSPSCRS
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
516904 | 1 | 1 | 0.62 | RoseTTAFold | 1-111 | 111 | 26 May 2023 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2023 University of Washington