IL6 1p9m

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
58970CompleteStructure prediction RatnakarIL6 1p9m18623 Feb 202126 Mar 2021
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    . 
   sequence: APPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
    psipred: -----------------------HHHHHHHHHHHHHHHHHHHHHHHH-------HHHHHHHH-------------------HHHHHHHHHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHH--------------HHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHH-
    spider3: -----------------------HHHHHHHHHHHHHHHHHHHHHHHH------HHHHHHHHHH------------------HHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHH-HHHHHHHHHHHHH--------------HHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHH--
 deepconcnf: ----------------------HHHHHHHHHHHHHHHHHHHHHHHHHH------HHHHHHH--------------------HHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHH-------------HHHHHH-----HHHHHHHHHHHHHHHHHHHHHHHHHHH--
   disopred: DDDDDDDDDDDDDDDDDDDDDDDDDD-----------------------------------------------D-D------------------------------------------------------DDDDDDDDDDDDDDDDDDDDDDDDDDD-----------------------------
      tmhmm: ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
57273110.77comparative modeling1-18618623 Feb 2021



Baker Lab | Rosetta@home | Contact | Terms of Service
©2021 University of Washington