xynB

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
620337CompleteStructure prediction YINxynB18812 Jun 20247 Aug 2024
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .   
   sequence: STPSSTGENNGFYYSFWTDGGGDVTYTNGDAGAYTVEWSNVGNFVGGKGWNPGSAQDITYSGTFTPSGNGYLSVYGWTTDPLIEYYIVESYGDYNPGSGGTYKGTVTSDGSVYDIYTATRTNAASIQGTATFTQYWSVRQNKRVGGTVTTSNHFNAWAKLGMNLGTHNYQIVATEGYQSSGSSSITVQ
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
614410110.90RoseTTAFold1-18818812 Jun 2024



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington