Ross goose

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
620388CompleteStructure prediction kuldeepkaur5056@gmail.comRoss goose6712 Jun 20247 Aug 2024
             1   .   10    .   20    .   30    .   40    .   50    .   60    .  
   sequence: MAQPGINLLIGQHLHTPLSRKQYISHIGYVGLKNYTPLHSELLAKVFLRRLCCCSLALYLWYVPLFM
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
614457110.53RoseTTAFold1-676712 Jun 2024



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington