exon6_6a
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
637576 | Complete | Structure prediction | todius | exon6_6a | 86 | 20 Oct 2024 | 4 Dec 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 .
sequence: VAAEELCCLLGQVFQVVYTESTIDFLDRAIFDGASTPTHHLSLHSASHVTSSTVTSSFDCQLPLHFRTLAITLSPPKFSRVISLFQ
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
631271 | 1 | 1 | 0.60 | RoseTTAFold | 1-86 | 86 | 20 Oct 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington