4xct.pdb
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
661474 | Complete | Structure prediction | ankitapati689 | 4xct.pdb | 157 | 13 Mar 2025 | 28 Apr 2025 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 .
sequence: DLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYG
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
654408 | 1 | 1 | 0.89 | RoseTTAFold | 1-157 | 157 | 13 Mar 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington