2kcr.pdb

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
67452CompleteStructure prediction luxiancui2kcr.pdb858 Apr 20218 May 2021
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .
   sequence: MKTSVVFLVVLTAGLLLLSEAAAEYRCELIRNLGKGKGSFTNYYYDKATNSCKTFRYRGTSGNGNRFKTLEECETTCVTGPDEVL
    psipred: --HHHHHHHHHHHHHHHHH-----HHH--------------EEEEE----EE--EE-------------HHHHHHH---------
    spider3: -HHHHHHHHHHHHHHHHHHHH-------------------EEEEEE----EEEEE--------------HHHHHHH---------
 deepconcnf: -HHHHHHHHHHHHHHHHHHHH-HHHH----------------EEEE----EEEE---------------HHHHHHH---------
   disopred: --------------------------------------------------------------------------DDDDDDDDDDD
      tmhmm: ----TTTTTTTTTTTTTTTTTTT--------------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
6552111n/acomparative modeling1-85858 Apr 2021



Baker Lab | Rosetta@home | Contact | Terms of Service
©2021 University of Washington