Arpiin model 3

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
67494ActiveStructure predictionQariArpiin model 32268 Apr 20218 May 2021
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    . 
   sequence: MSRIYHDGALRNKAVQSVRLPGAWDPAAHQGGNGVLLEGELIDVSRHSILDTHGRKERYYVLYIRPSHIHRRKFDAKGNEIEPNFSATRKVNTGFLMSSYKVEAKGDTDRLTPEALKGLVNKPELLALTESLTPDHTVAFWMPESEMEVMELELGAGVRLKTRGDGPFLDSLAKLEAGTVTKCNFTGDGKTGASWTDNIMAQKCSKGAAAEIREQGDGAEDEEWDD
    psipred: --------------EEEEE------HHHH----EEEEEEEEEEEEEEEEE------EEEEEEEEEE-EEEEEEE--------------EEEEEE------EE----------HHHHHHHH--HHHHH----------EEEEE-HHH----------EEEEEE-----EEEEEEEE----EEE------------HHHHHHH-------------------------
    spider3: --------HH-----E---------HHHH-----EEEEEEEEEEEEEEEE-----EEEEEEEEEEE-EEEEEEE-----EE-------EEE-------EEEEE---------HHHHHHHH--HHHHHHHHHH-----EEEEE-HHHH---------EEEEEE-----EEEEEEEE----EEEEEE---------HHHHHHH-------------------------
 deepconcnf: ---------------------------------EEEEEEEEEEEEEEEEE-----EEEEEEEEEE---EEEEEE-----EE-----------------EEEEEE--------HHHHH-----HHHHHHHH------EEEEEEE-------------EEEEEE-----HHHHHHE-----EEE------------HHHHHH--------------------------
   disopred: D----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DDDDDDDDDDDDDDDDDDDDDDDDDDDDD
      tmhmm: ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
65855110.00comparative modeling1-2262268 Apr 2021
-12n/aab initio1-226226-



Baker Lab | Rosetta@home | Contact | Terms of Service
©2021 University of Washington