1.YfhK 19 celB protein

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
68725ExpiredStructure prediction mbmobina1.YfhK 19 celB protein6511 Apr 202111 May 2021
             1   .   10    .   20    .   30    .   40    .   50    .   60    .
   sequence: MKKKQVMLALTAAAGLGLTALHSAPAAKAEGSYADLAEPDDDWLHVEGTNIVDKYGNKVWITGAN
   disopred: DDDDDDDD--------------------------------------------------------D
      tmhmm: -----------------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
66790110.63TrRefineRosetta1-656511 Apr 2021



Baker Lab | Rosetta@home | Contact | Terms of Service
©2021 University of Washington