p118
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 695829 | Complete | Structure prediction | michelle | p118 | 109 | 5 Dec 2025 | 19 Jan 2026 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 .
sequence: MMTDTQLFEYLYFSPKTIKNKLVNHFEILAKNNILSEFYPKQYKLQKGVFKGCRVLCTAPNARLMNKIPYFTMEFIDGPFKGLITQSLMAYDSEPFLIKEQSWINLFSN
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 686575 | 1 | 1 | 0.71 | RoseTTAFold | 1-109 | 109 | 5 Dec 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington